PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 382aa    MW: 41949.1 Da    PI: 7.3693
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.1e-3954114262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++  lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  XP_009759498.1  54 QQPPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 114
                     56789*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.1E-3357112IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-2858112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52558112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MLGDCEKMVL IPSSTTNEWP QQNIQSDEKA LMMSSNGSSD MEKPIQDPQQ QQQQQPPLKC  60
PRCDSSNTKF CYYNNYSLSQ PRHFCKACKR YWTRGGTLRN VPVGGGCRKN KRIKRPSASS  120
SSTHDITITS SSALNNTISA TNPSHHHHIH GSHNIDLSST TSSNHLNPLF YGLNTERSDL  180
NNNPFARLFS SRVSNATDEG QVYSLTDSIP GLDRRLGLGF SSSSGLMGEN NYGHGFNSIK  240
QIQDVMTNSN TTNSSSLLSS YPMFGSSSTS SSTSTMASLI ASSLQQQKFI SNGNNFHSLA  300
PYEELQMSGN NNNNNNVESG DGMTMLKEEK IEGGGQNRLN WNNLSNHQIH EQIMNSSDPS  360
LSWNGAWLDP SNMGSNSVPS LI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6726013e-37DQ672601.1 Lycopersicon esculentum cultivar Ailsa Craig leucine-rich repeat family protein, putative polyprotein, auxin repressed/dormancy associated protein, putative zinc finger protein, putative protease/hydrolase, mitochondrial amino acid carrier, squamosa promoter binding-like protein, putative retroelement pol polyprotein, and Dof zinc finger protein genes, complete cds.
GenBankHG9754413e-37HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755143e-37HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
GenBankJX0228913e-37JX022891.1 UNVERIFIED: Solanum lycopersicoides voucher UCD:TGRC LA2408 putative Dof zinc finger protein-like (Dof01) gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759498.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLM1CWS81e-132M1CWS8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000764471e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-37Dof family protein